Protein Info for SM_b20184 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR03864: ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system" amino acids 4 to 234 (231 residues), 357.6 bits, see alignment E=1.4e-111 PF00005: ABC_tran" amino acids 19 to 162 (144 residues), 116.7 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 100% identity to sme:SM_b20184)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WX8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>SM_b20184 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MIGLEISHVSYSYGKSRALDDVSFSVRTGRFCALLGPNGAGKSTLFALLTRLLATRAGTI
GVAGFDIAREPRAALARIGVVFQQPTLDLDMSVRRNLRYFAGLHGLSGRQAAVAIEAALT
QLGMAERADEQVRALNGGHRRRMEIARALIHKPQILLLDEPTVGLDAASRQAITDHVHLL
AESGLAVLWATHLVDEIRPEDQVVVLHRGKVLSDGTAAELAGGQGLAKAFLSMTAEGREV
PA