Protein Info for SM_b20173 in Sinorhizobium meliloti 1021

Annotation: methanol dehydrogenase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 18 to 558 (541 residues), 787.2 bits, see alignment E=3.8e-241 PF01011: PQQ" amino acids 36 to 362 (327 residues), 165.4 bits, see alignment E=3.5e-52 amino acids 495 to 550 (56 residues), 38.7 bits, see alignment 7.9e-14 PF13360: PQQ_2" amino acids 80 to 214 (135 residues), 48.4 bits, see alignment E=1.5e-16 amino acids 476 to 538 (63 residues), 20.8 bits, see alignment E=4.1e-08

Best Hits

Swiss-Prot: 79% identical to XOXF_PARDE: Putative dehydrogenase XoxF (xoxF) from Paracoccus denitrificans

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3993)

Predicted SEED Role

"Methanol dehydrogenase large subunit protein (EC 1.1.99.8)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WY9 at UniProt or InterPro

Protein Sequence (601 amino acids)

>SM_b20173 methanol dehydrogenase, large subunit (Sinorhizobium meliloti 1021)
MKRLLTMLAIMSIGGGAQVAFANDELQKLIDDPNQWAIQTGDYANLRYSKLDQINKDNVG
KLQVAWTFSTGVLRGHEGSPLVIGDLMYVHTPFPNTVYALDLSKDGQIVWKYEPKQDPNV
IPVMCCDTVNRGVAYADNKIFLHQADTTVVALDAKTGKVIWSVKNGDATKGETNTATVMP
VKDKILVGISGGEFGVRGHVTAYSMADGKVLWRGYSMGPDSDTLIDPEKTTHLGKPVGKD
SGLTTWEGDQWKIGGGTTWGWYSYDPEENLVYYGTGNPSTWNPTQRPGDNRWSMTIFARD
VDTGMAKWLYQMTPHDEWDYDGVNEMILTEQQIDGKDRKLLTHFDRNGFGYTMDRVTGEL
LVAEKYDPTVNWATEVVMDPKSDKYGRPQVVAQYSTEQNGEDTNTTGVCPAALGTKDQQP
AAYSPKTELFYVPTNHVCMDYEPFRVSYTAGQPYVGATLSMYPPKDSHGGMGNFIAWDNK
EGKIKWSLPEPFSVWSGALATAGDVVFYGTLEGYLKAVDAATGKELYRFKTPSGVIGNVM
TYAREGKQYVAVLSGVGGWAGIGLAAGLTNPTEGLGAVGGYSALSNYTALGGTLTVFKLP
E