Protein Info for SM_b20171 in Sinorhizobium meliloti 1021

Annotation: carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR02821: S-formylglutathione hydrolase" amino acids 6 to 277 (272 residues), 476.9 bits, see alignment E=1e-147 PF00756: Esterase" amino acids 25 to 275 (251 residues), 185.2 bits, see alignment E=2e-58

Best Hits

Swiss-Prot: 64% identical to SFGH_PARDP: S-formylglutathione hydrolase (fghA) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K01070, S-formylglutathione hydrolase [EC: 3.1.2.12] (inferred from 100% identity to sme:SM_b20171)

MetaCyc: 47% identical to S-formylglutathione hydrolase FrmB (Escherichia coli K-12 substr. MG1655)
S-formylglutathione hydrolase. [EC: 3.1.2.12]

Predicted SEED Role

"S-formylglutathione hydrolase (EC 3.1.2.12)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 3.1.2.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.12

Use Curated BLAST to search for 3.1.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WZ1 at UniProt or InterPro

Protein Sequence (280 amino acids)

>SM_b20171 carboxylesterase (Sinorhizobium meliloti 1021)
MSAKMELVTQSQCFGGTQSVYRHASEVCGVEMTFGLYMPPQARTRSVPLLWYLSGLTCTH
ENAMIKAGLQRHAAEQGLALVFPDTSPRGEGVADDEAYDLGQGAGFYVNATQKPWSPHYR
MYDYIVTELPALLQEQLPLNGVNGITGHSMGGHGALTIAFRNPELFRSVSAFAPIVNPTR
SDWGRKQFSAYLGDDEADWGSYDACLLLGELGWHGDILIDQGAADQFLDELQPEAMARLL
AERRQAGVVRLQAGYDHSYYFVASFGEDHVRWHAERLNAA