Protein Info for SM_b20164 in Sinorhizobium meliloti 1021

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 PF13188: PAS_8" amino acids 218 to 269 (52 residues), 16.9 bits, see alignment 1.2e-06 PF12860: PAS_7" amino acids 223 to 335 (113 residues), 73 bits, see alignment E=5.6e-24 PF00512: HisKA" amino acids 385 to 448 (64 residues), 45.4 bits, see alignment E=1.7e-15 PF02518: HATPase_c" amino acids 494 to 601 (108 residues), 87.8 bits, see alignment E=1.7e-28 PF00072: Response_reg" amino acids 626 to 738 (113 residues), 46.7 bits, see alignment E=8.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20164)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WZ8 at UniProt or InterPro

Protein Sequence (747 amino acids)

>SM_b20164 sensor histidine kinase (Sinorhizobium meliloti 1021)
MIDPNEPYELQIAKQARIIEALVNRAERGHEVGGSAYSLFESAIALQAEVWEKTKDLEKA
LDTLDRASSELEVAYQAQERIQRNLADAMVAMEDGFALFSEERLQACNAQFRNLLPDVEP
LIKPGLGFDDYLAAVNASKYLNREENGLAARPHPVAREQGSGQRFSSFVMVLRNDRWFQI
SYRQTSSGNITVLQTEITDIVRENRREKNRLIDQQSHLLQAAFDHMSLGICTFSSGGELL
VRNERFGELLGVPLSLLKKGSPFQRIVEHVERHEILDREGRRSRVAGWFKAVRRGEAVQE
RFRRRDGMSLDIRIHSLPDDGFIVSIMDVTAETQASALLEQRVQERTAELTEANRLLQIH
ADEQTKIEAALRHAKEAAEAAHTSKTRFLAAASHDLLQPINAAKLYLSMLTDKVGQPGTE
EVVRRLKRSFTSIESLLQALLDISRLDSSGAEFNVTSFNLGNLLQGVAEDLAPLATERGI
DLRIVPSSRWVSSDQRYLMRCVQNLVVNAIQYTERGRVLVGCRLTGDAVRIEVWDTGVGI
SEEDRTRIFKEFTRASGAAKGPGMGLGLSIVERACRHLDHPIRLASQPGRGSVFSIEVPL
AAPGHASVSEDPRMEPMLDGSLDLIVMIVENDADELHAMTQVLESWGASVLAADSTADAA
ALMQEIGTAPDILLVDYQLDDEDNGIETIHTLRALAGAEIPAIIISANRQRQFLQLCNEM
SFAVLTKPVQLVRLRALIDWKTRARVA