Protein Info for SM_b20153 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 16 to 150 (135 residues), 111.8 bits, see alignment E=2.7e-36 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 70 to 521 (452 residues), 335.7 bits, see alignment E=2.4e-104 PF01895: PhoU" amino acids 342 to 420 (79 residues), 37.1 bits, see alignment E=3.4e-13 amino acids 446 to 529 (84 residues), 36.8 bits, see alignment E=4.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20153)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X09 at UniProt or InterPro

Protein Sequence (547 amino acids)

>SM_b20153 hypothetical protein (Sinorhizobium meliloti 1021)
MESAIVGINVFGAVALLLYGLAQVKDGMSRAWGARLRTGLAAGTRGGLRSFAAGFVATVA
LQSSTATALMVASFVEKELIAPAMAQVVLLGANVGTAATAWIVALGLGWLSPLLILAGVA
LGRTRSSARSGAGSAVVGIGLMLLSLHLLANATDPLLQSPALGAFLAMLDNAWPVALFFA
AALAVLASSSLAIVVLILSLASAGGISTSLVVVLVLGANLGGAVPPVLATLGASADARRV
TIGNLIVRAIGCVIALPLAGYCAEFMELARLSPQKLAVDAHLLFNLAVAMIAFPVSPLLY
RLTASLIPQETESDIGPRYLDMEALARPVAALAGAGREVMAVGDLIEGMLVRALDALKGN
DLSMLADISMLEGRVDRIQHEIKLYVSRVGKDDMTEDDHRRARHIVDYAINLEHIGDIIE
KGLHPEIAKKISRGLRFSEDGQGELVRLFAITLDNMRMAQAVFATGDAELARRLVEVKEE
VRRLEKQSAECHLQRLREGRLDSMQTSSLHLDMLRDLKRINAHVASVAHPILDDSGLLIE
SRIRQPV