Protein Info for SM_b20148 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00392: GntR" amino acids 16 to 75 (60 residues), 66.9 bits, see alignment E=2e-22 PF14502: HTH_41" amino acids 33 to 74 (42 residues), 26 bits, see alignment 9.9e-10 PF01022: HTH_5" amino acids 39 to 66 (28 residues), 22.3 bits, see alignment (E = 1.9e-08) PF07729: FCD" amino acids 99 to 222 (124 residues), 86.4 bits, see alignment E=4.5e-28

Best Hits

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 100% identity to sme:SM_b20148)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X14 at UniProt or InterPro

Protein Sequence (233 amino acids)

>SM_b20148 transcriptional regulator (Sinorhizobium meliloti 1021)
MGLQEGTPRKGLPDIVFERMHRAIKSGAYKPDERLPTEHELATEFEVSRPIVREALKRLR
DQGLIYSRRGAGSFVRAVGLREPLGFGQLENVADLLNCYEFRLTLEPAAAAAAALRHDET
SLASIRRALELLRDATNRQSHREDADFQFHLAIARAAQNSYFSTAMEALKEHIAVGMKFH
GISVKREASGLSRVFAEHEAIADAIAAGSAEEARMLMLKHLTGSRDRLFLASQ