Protein Info for SM_b20134 in Sinorhizobium meliloti 1021

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 243 to 267 (25 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 15 to 439 (425 residues), 372.8 bits, see alignment E=2.3e-115 PF00860: Xan_ur_permease" amino acids 18 to 406 (389 residues), 348.7 bits, see alignment E=1.8e-108 TIGR03173: xanthine permease" amino acids 22 to 441 (420 residues), 531.5 bits, see alignment E=1.3e-163

Best Hits

Swiss-Prot: 51% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to smk:Sinme_4033)

MetaCyc: 51% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X28 at UniProt or InterPro

Protein Sequence (463 amino acids)

>SM_b20134 permease (Sinorhizobium meliloti 1021)
MNTDSKCDAIEAMFPAPKLAALGLQHVLVMYAGAIAVPLIIGSALNLSKDQIAMLISADL
FCCGIVTLIQCLGVWNVGARLPIMMGIGFTAVPPIIATGTDPDLGMPGVLGAVIASGVFT
LLAAPYFSRWVRFFPAVVTGTVMLVIGLSLMRVGVNWAAGGQPMIKGPDGLIPNPAYGEP
FALAVAAIVLVSILLMTRFLKGFLANLAVLFGIGIGFAIAVAFGKVDFQGVADASWVTVV
TPFAFGMPIFDLWATVALCTVMIVMMIEATGQILAVGDMAGRTISEADLARGLRTDGLGN
IIGGIFNTFTYTTYAQNVGLLQITGVMSRWAVAAGGVVLILLGCLPKIAFITASIPSYVV
GGAAIVMFGMVSATGVKILARVNFVDNRRNLYIVAVSVGLAMIPVVADKIFAQLPEFIDR
FFHSGVLVGTFSAVLLNLLFNGVPPREEVQPDLLGEGAMRHPG