Protein Info for SM_b20131 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF00111: Fer2" amino acids 8 to 56 (49 residues), 36.9 bits, see alignment E=2.8e-13 PF01799: Fer2_2" amino acids 75 to 149 (75 residues), 111.1 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 53% identical to NDSFS_EUBBA: Nicotinate dehydrogenase small FeS subunit (ndhS) from Eubacterium barkeri

KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 100% identity to smk:Sinme_4036)

MetaCyc: 57% identical to 4-hydroxybenzoyl-CoA reductase HbaB subunit (Rhodopseudomonas palustris CGA009)
OHBENZCOARED-RXN [EC: 1.1.7.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.1.7.1 or 1.2.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X31 at UniProt or InterPro

Protein Sequence (161 amino acids)

>SM_b20131 oxidoreductase (Sinorhizobium meliloti 1021)
MNRLVSMTVNGEARELAVVPNRTLLDALRNEGSLTGTKKGCDVGDCGACTVIMDGRPVNA
CLVLAIEAEGATIETIEGLQPAYDQPHLLQQKFMEHGGAQCGFCTPGIIMMAKALLDENP
DPSEDEIRFALAGNICRCTGYTKIIDAVRATAEELRKAGTL