Protein Info for SM_b20126 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 108 to 122 (15 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 74 to 350 (277 residues), 149.9 bits, see alignment E=4.2e-48

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4041)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X36 at UniProt or InterPro

Protein Sequence (365 amino acids)

>SM_b20126 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MANSESGQPLAVVPQAYGALWRGLLGPLRTIIQPAAAVVLALACGAALLAFNGYEARAVI
DVMVLGVFQDTRSIAEILLKATPLILIGVGLCVAFRCSIWNIGAEGQFYAGAIAATAAGV
SFDGLTAWIYVPLVMIAGALAGAAWAAIAGLLKVYFRASEIVTTIMLNYIAIIMTSYLVT
GPLRDAAAAYPQSARLVQEAWMPRILPPTRLHIGILVALALAVVMYIFLFRSTRGYALRV
VGISPDAARYAGISVPRNIMLSICLSGSMAGLAGAFEIAGVTRRLFQSISPGYGFEGIAV
ALLANNNPIGAVFSGLLFAILRSGSELMQITAQVPQVLVLVIQGIVILSVVGFAVLRIPS
MRPSE