Protein Info for SM_b20125 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 232 to 261 (30 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 290 (274 residues), 130.3 bits, see alignment E=3.9e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4042)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X37 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SM_b20125 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MEDVASLSFLAATIAASWRLAAPLMFASIGEVFSERAGVLNIGLEGVMLAGAFAGFAAAF
TSGSILLGVAAAVAAGVLVGLLFAFFTITIKADQIVVGAAINLLGLGLTAFLFRAYFSSA
GKGIEIAKPVDLPWLSDLPFFGEAFFRQNAFVYSTLPVAALAVFVLYRTSFGLTLRAVGE
HPKAVDVSGRSVALYRYGAVLICSALAALGGAFLTLAHSNQFVEGISSGRGFIALAVVVF
ARWSPIGAFIVSLLFGVFYALQLQLQAQPVLFLPYQLFQALPYVMTIAALILVRNRVDTP
SMLGVAYKKS