Protein Info for SM_b20112 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 148 (137 residues), 46.2 bits, see alignment E=2.6e-16 amino acids 157 to 287 (131 residues), 45.9 bits, see alignment E=3.3e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4055)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X50 at UniProt or InterPro

Protein Sequence (295 amino acids)

>SM_b20112 hypothetical protein (Sinorhizobium meliloti 1021)
MKKIALPAVVAGALLMGANSLVAAMDGVIVRFVAGEVHPIGIVFFRNLASLIALYLLLCR
RGFPLGIAQSSGRAMHFSVHAIRAVIKLLALVAAFIAVTEIPLASATAIAFTMPLFVALG
SVLFLGERFSAARVFGLVAGFAGILIVVRPGAATFQSGAAWALASAVGLAIVALLMKVSA
EREDPLSIAWLNLLVTVPVAFVMALPFWQTPSLFSLALMTLQGIGGLFAQLSFARAMKLA
DASLLVIVDFIRLPIALILGLVLFGEPIRLEVVIGGAIILGAIALLFHREGKRRG