Protein Info for SM_b20101 in Sinorhizobium meliloti 1021

Annotation: hydroxyglutarate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF01266: DAO" amino acids 14 to 402 (389 residues), 225.6 bits, see alignment E=2e-70 PF13450: NAD_binding_8" amino acids 17 to 49 (33 residues), 22.6 bits, see alignment (E = 1.6e-08)

Best Hits

Swiss-Prot: 52% identical to LHGD_ECOLI: L-2-hydroxyglutarate dehydrogenase (lhgD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20101)

MetaCyc: 52% identical to (S)-2-hydroxyglutarate oxidase (Pseudomonas putida KT2440)
1.1.3.M4 [EC: 1.1.3.M4]

Predicted SEED Role

"L-2-hydroxyglutarate oxidase (EC 1.1.3.15)" (EC 1.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.3.15 or 1.1.3.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92X61 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SM_b20101 hydroxyglutarate oxidase (Sinorhizobium meliloti 1021)
MPAESGGRGCGLYDYCIIGGGIVGLATAMALQERMGGASIVLLEKERELARHQTGHNSGV
IHAGIYYAPGSLKAKLCREGAEATKEFCTGNGISFETCGKLLVATNDAEIERMESLEERA
QQNGIEYTRLSKSQLRSDEPNIAGLSALLVHATGIVDYSAVCRAMAERIEVRGGEIRCGV
EATAIAEEDGGVRIASATGRIEARRLIACAGLQSDRIALMAGLSIDHRIVPFRGEYYVLP
ASKAGVTRRLIYPIPDPNLPFLGIHLTRTIDGGMTVGPNAVLGFAREGYPKGSFKAADVA
NMAAFPGFWKMAAKNWRSAITEFANSASRFRYLRECRKYCPSLTIDDLAVPQAGIRAQAV
MADGSLVHDFLFKQTERMLHVCNAPSPAATSAIPIGRMIVDRLLDGAPPATERSQSLHGT
HAQLHR