Protein Info for SM_b20057 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 251 to 279 (29 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details PF01032: FecCD" amino acids 26 to 340 (315 residues), 287 bits, see alignment E=1.6e-89 PF00950: ABC-3" amino acids 121 to 315 (195 residues), 33.3 bits, see alignment E=3.9e-12

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to smk:Sinme_4112)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XA5 at UniProt or InterPro

Protein Sequence (347 amino acids)

>SM_b20057 ABC transporter permease (Sinorhizobium meliloti 1021)
MSRVLTLAGRTGTGRVGAALAALVILFAALWMGAAIGETAIPFKTVAQTVANRLWNAGYP
LAPIDEGIIWSYRLSRAVVAASCGASLALSGAVLQSLLRNPLADPYILGISAGASTGAVS
VAILGVGAGMLTLPLGAFIGALVAFVLVSLLAVKAGRGTAAIILAGVAGSQLFNALTSFI
VTKAATAEQARGIMFWLLGNLSGVRWPDAWLAVPATLLGLVVCLWHARPLDAFTFGSESA
ASLGISVRRTYFALVGVSAMMTAVMVSIVGSIGFVGLVIPHAARMLVGVRHGVLLPAAAL
IGAVFMILADILSRVLIPGQVLPIGVITALVGAPAFALILGQRRDRA