Protein Info for SM_b20026 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details PF07331: TctB" amino acids 13 to 144 (132 residues), 61.9 bits, see alignment E=3.9e-21

Best Hits

Swiss-Prot: 32% identical to YTZ1_AGRVI: Uncharacterized 16.3 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20026)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XD3 at UniProt or InterPro

Protein Sequence (153 amino acids)

>SM_b20026 hypothetical protein (Sinorhizobium meliloti 1021)
MKSISFDTTNALCGGILTAVGLFFAWQSLGLELGTAFRMGPGYFPLVLSAVLILLGLIIL
IQSARVHSEPMGPIAIRGIFFILPAPIFFGLTVRGLGFVPSLFFTALIACFASSRMKPLW
AIALSLALTIFSVGVFSYGLNLPFERFGPWTRF