Protein Info for SM_b20016 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 318 (266 residues), 90.8 bits, see alignment E=4.4e-30

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20016)

Predicted SEED Role

"Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XE3 at UniProt or InterPro

Protein Sequence (330 amino acids)

>SM_b20016 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MAETATVPTYRRAGGIGRLLERYPFLPALVIVAALLLLNGFFSPNSLTFRALTGLLSTYM
ALILLAIAQTYVVYAGDIDLSAGAILSLVNVAIVVLMERWGGGAGAVFLALAIGLLLGLA
CGLVNGLVVAALRLQAIVATFATSIFFTGLALYILPVAGTPAPALFWRTYGGRLFGVPFV
FYILAALVILLAVMSRTRLVTQLLAVGDDQQAAYQTGLPVIATRIKGYVLCGLFSALAAF
CITGDTASGDPLVGGKMTLYSVAAVVLGGSALSGGWGTVVGSLLGALTIGLINSVVFFMG
TPSEWQNFVQGLAILLVLMAGVLAGRRARS