Protein Info for SM_b20002 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for Lactose, ATPase component
Rationale: Specific phenotype on Beta-Lactose. (KEGG_correct)
Original annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 123.8 bits, see alignment E=1.6e-39 PF17912: OB_MalK" amino acids 235 to 286 (52 residues), 41.9 bits, see alignment 3e-14 PF08402: TOBE_2" amino acids 279 to 349 (71 residues), 31.1 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 56% identical to MALK_VIBCH: Maltose/maltodextrin import ATP-binding protein MalK (malK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10191, lactose/L-arabinose transport system ATP-binding protein (inferred from 100% identity to sme:SM_b20002)

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XF6 at UniProt or InterPro

Protein Sequence (358 amino acids)

>SM_b20002 ABC transporter for Lactose, ATPase component (Sinorhizobium meliloti 1021)
MSELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDL
TIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAAHI
LELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIARLH
KQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGSPKMN
FLKGVIEIDEDQAYARLPDYGDAKIPVTLQAAAGTAVTIGIRPEHFDEAGPAALDLAIDM
LEHLGGETFAYARHHGNGELIVVETKNGRGLKTGDRLTARFDPVSVLVFDGEGKRLRS