Protein Info for SGL_RS18375 in Synechocystis sp000284455 PCC 6803

Annotation: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF01502: PRA-CH" amino acids 39 to 113 (75 residues), 120.2 bits, see alignment E=2.6e-39 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 127 to 210 (84 residues), 100.9 bits, see alignment E=1.8e-33 PF01503: PRA-PH" amino acids 127 to 213 (87 residues), 84.4 bits, see alignment E=6e-28

Best Hits

Swiss-Prot: 100% identical to HIS2_SYNY3: Histidine biosynthesis bifunctional protein HisIE (hisI) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K11755, phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19 3.6.1.31] (inferred from 100% identity to syn:slr0608)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.5.4.19, EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19 or 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>SGL_RS18375 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE (Synechocystis sp000284455 PCC 6803)
MSHSDLPLANAVPLDKIRYNDQGLVPAIAQDYLDGTVLMLAWMNEAALAKTLATGQVWYW
SRSRQELWHKGATSGHFQKLLGIRYDCDSDALLLTIEQKGDIACHTGERSCFHQLDGHKS
PPPADMLTELARVIGDRRDHPTPESYTCKLLAGGDNKILKKIGEESAEVVMACKDDDPEA
IAGEVADLFYHTLVALAHHNVDLRAVYRKLGDRRR