Protein Info for SGL_RS17905 in Synechocystis sp000284455 PCC 6803

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF00196: GerE" amino acids 166 to 219 (54 residues), 62.3 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:sll1544)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>SGL_RS17905 response regulator transcription factor (Synechocystis sp000284455 PCC 6803)
MEFDPDSLVFNARYDLFQLLVNHFNVIACLYPRLFAVSVARISSQRPNKKKVKIFTLQSE
ALTYFEQQPEPLVVVICQRLEDGSGLDLLKQLKAHARSPQCLLLLLNDHAAIVEEAQQYG
ADAIFLESSLGNGEINLAVECLLQGRTYIDSRLEAIADYRKSQKDELTQREVAILRLVAE
GKTNSEIGQELHLASSTVREYVQTIMRKLNARDRTSAAIAGLREGYLT