Protein Info for SGL_RS17890 in Synechocystis sp000284455 PCC 6803

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 4 to 277 (274 residues), 345 bits, E=1.6e-107
• PF01678: DAP_epimerase
  • amino acids 5 to 125 (121 residues), 125.2 bits, E=7.9e-41
  • amino acids 157 to 272 (116 residues), 132.1 bits, E=5.7e-43

Best Hits

Swiss-Prot: 100% identical to DAPF_SYNY3: Diaminopimelate epimerase (dapF) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 100% identity to syn:slr1665)

MetaCyc: 64% identical to diaminopimelate epimerase (Zea mays)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis I (7/9 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Protein Sequence (279 amino acids)

>SGL_RS17890 diaminopimelate epimerase (Synechocystis sp000284455 PCC 6803)
MALSFSKYHGLGNDFILVDNRQSTEPCLTPDQAQQLCDRHFGIGADGVIFALPGQGGTDY
TMRIFNSDGSEPEMCGNGIRCLAKFLADLEGVEEKTYRIHTLAGVITPQLLADGQVKVDM
GEPQLLAELIPTTLAPAGEKVVDLPLAVAGQTWAVTCVSMGNPHCLTFVDDVDSLNLTEI
GPLFEHHPQFSQRTNTEFIQVLGSDRLKMRVWERGAGITLACGTGACATVVAAVLTGRGD
RRCTVELPGGNLEIEWSAQDNRLYMTGPAQRVFSGQAEI