Protein Info for SGL_RS17290 in Synechocystis sp000284455 PCC 6803

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 1 to 416 (416 residues), 407.4 bits, E=6.9e-126
• PF00696: AA_kinase
  • amino acids 3 to 232 (230 residues), 186.4 bits, E=1.8e-58
• TIGR00657: aspartate kinase
  • amino acids 63 to 417 (355 residues), 414.2 bits, E=7.7e-128
• PF01842: ACT
  • amino acids 275 to 321 (47 residues), 30 bits, 9.1e-11
  • amino acids 450 to 512 (63 residues), 42 bits, E=1.5e-14
• PF13840: ACT_7
  • amino acids 351 to 413 (63 residues), 57.7 bits, E=2.1e-19
  • amino acids 523 to 583 (61 residues), 54.1 bits, 2.9e-18
• PF22468: ACT_9
  • amino acids 358 to 416 (59 residues), 81.4 bits, 7.9e-27
  • amino acids 452 to 505 (54 residues), 31.7 bits, 2.6e-11
  • amino acids 530 to 588 (59 residues), 87.5 bits, 9.7e-29

Best Hits

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to syn:slr0657)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis I (7/9 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• spermidine biosynthesis II (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (5/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (5/9 steps found)
• ectoine biosynthesis (2/5 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (4/8 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• superpathway of polyamine biosynthesis III (3/8 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (4/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Protein Sequence (600 amino acids)

>SGL_RS17290 aspartate kinase (Synechocystis sp000284455 PCC 6803)
MALIVQKFGGTSVGTVERIQAVAQRIKRTVQGGNSLVVVVSAMGKSTDVLVDLAQQISPN
PCRREMDMLLSTGEQVSIALLSLALQEIDQPAISLTGAQVGIVTEAEHSRARILEIRPDR
LEHHLREGKVVVVAGFQGISSVEHLEITTLGRGGSDTSAVALAAALKADFCEIYTDVPGI
LTTDPRLVPEAQLMAEITCDEMLELASLGAKVLHPRAVEIARNYGIPLVVRSSWSDEPGT
KVVAPPVQNRSLVGLEIAKAVDGVEYDADQAKVALLRVPDRPGVASKLFRDIAQQQVDID
LIIQSIHDGNSNDIAFTVVKDLLNTAEAVTSAIAPALRSYPEADQEAEIIVEKGIAKIAI
AGAGMIGRPGIAAKMFKTLADVGVNIEMISTSEVKVSCVIDQRDADRAIAALSNAFGVTL
SPPKNQTDTSHLPAVRGVALDQDQAQIAIRHVPDRPGMAAQLFTALAEANISVDMIIQSQ
RCRINQGTPCRDIAFMVAEGDSSQAEAILQPLIKDWLDAAIVVNKAIAKVSIVGSGMIGH
PGVAAHFFAALAQENINIEMIATSEIKISCVVPQDRGVDALKAAHSAFNLAGTKTVTVPA