Protein Info for SGL_RS17240 in Synechocystis sp000284455 PCC 6803

Annotation: photosystem I reaction center subunit PsaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PSAK2_SYNY3: Photosystem I reaction center subunit PsaK 2 (psaK2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02698, photosystem I subunit X (inferred from 67% identity to cyj:Cyan7822_3382)

MetaCyc: 100% identical to Photosystem I reaction center subunit PsaK 2 (Synechocystis sp. PCC 6803)
RXN-15479 [EC: 1.97.1.12]

Predicted SEED Role

"alternative photosystem I reaction center subunit X (PsaK2)" in subsystem Photosystem I

MetaCyc Pathways

ethene biosynthesis V (engineered) (24/25 steps found)
oxygenic photosynthesis (17/17 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (23/26 steps found)
1-butanol autotrophic biosynthesis (engineered) (22/27 steps found)
photosynthesis light reactions (4/4 steps found)
superpathway of photosynthetic hydrogen production (5/6 steps found)
cyclic electron flow (2/3 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.12

Use Curated BLAST to search for 1.97.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (90 amino acids)

>SGL_RS17240 photosystem I reaction center subunit PsaK (Synechocystis sp000284455 PCC 6803)
MFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKT
FGLPELLATMSFGHILGAGMVLGLASSGIL