Protein Info for SGL_RS16645 in Synechocystis sp000284455 PCC 6803

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 309 (198 residues), 51.4 bits, see alignment E=5.9e-18

Best Hits

Swiss-Prot: 54% identical to AGLF_RHIME: Alpha-glucoside transport system permease protein AglF (aglF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10233, alpha-glucoside transport system permease protein (inferred from 83% identity to syp:SYNPCC7002_A2037)

Predicted SEED Role

"ABC alpha-glucoside transporter, inner membrane subunit AglF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>SGL_RS16645 sugar ABC transporter permease (Synechocystis sp000284455 PCC 6803)
MFYRVVNVLLAIAIGCGGVIGLFYLANYAINALPKPWNKRILPWVYVTPALLFLSAYLIL
PTLETVYLSFFDGRSRNFVGLKNYVFAFTDHTMLVAFRNNLLWLVLVTGISVSLGLIIAV
LVDKVRYEAIAKSIIFLPMAISFVGASVIWKFVYAYRPAGAEQIGLLNAIVTSLGFAPVG
WLVERSVNNFALIAIMIWLYTGFCMVILSAAVKGIPADVIEAARIDGANSWQIFWRITIP
MIRSTLLVVSTTMVILVLKVFDIVFVMTGGNQGTEVIASLMIKEMFNYRNFGRGSTIAVI
LLLLIVPVMITNIRRFKAQEKLR