Protein Info for SGL_RS15770 in Synechocystis sp000284455 PCC 6803

Annotation: CIA30 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF01370: Epimerase" amino acids 2 to 85 (84 residues), 25.4 bits, see alignment E=1.8e-09 PF05368: NmrA" amino acids 2 to 79 (78 residues), 29.1 bits, see alignment E=1.6e-10 PF13460: NAD_binding_10" amino acids 6 to 126 (121 residues), 30.6 bits, see alignment E=6.2e-11 amino acids 317 to 413 (97 residues), 47.9 bits, see alignment E=3e-16 PF08547: CIA30" amino acids 139 to 304 (166 residues), 159.3 bits, see alignment E=1.7e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:sll0096)

Predicted SEED Role

"similar to nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>SGL_RS15770 CIA30 family protein (Synechocystis sp000284455 PCC 6803)
MILVVGATGGVGKRVVKLLIDGGQEVRVLVRDVPRAKKLFQAWFGGRLPDRLEFFGGDLT
IRESLTPALMARVTAVICCSGTKVQPVEGDTPQREKYYQGLKFYLPEVVDVPEQVEYEGI
KNLLAVVKEHIQPKENTLIDFRQTDSPRLAWYSVDDGVMGGVSASQWQLTGDRALFTGEV
STANNGGFASVRSPNFEPALDLSYAEGIQLRIQGDGKRYKFIIRSQNDWDGLSYCYSFDT
FNNRPQTVCIPFQQLIPVFRAKTVPEKGPFNSAQVSAFQLMHSKFEYDGGLNPSFSPGIF
GLEIESIKTYANPLTPQFIHVSSAGVTRPDRPGLNLDEEPPAVRLNDQLGGILTWKLRGE
DAIRGSGLTYTIVRPCALTESENPEMMQFAQGDNLRGQVSRWAIAKLCVDSLQWAEAGGK
TFEVSAREPGRNQAAWPFLLKQLNFDQR