Protein Info for SGL_RS15265 in Synechocystis sp000284455 PCC 6803

Annotation: SufS family cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 12 to 414 (403 residues), 623.4 bits, E=7.9e-192
• PF00266: Aminotran_5
  • amino acids 30 to 402 (373 residues), 490.8 bits, E=5.3e-151
• PF00155: Aminotran_1_2
  • amino acids 70 to 207 (138 residues), 25.4 bits, E=1.7e-09
• PF01041: DegT_DnrJ_EryC1
  • amino acids 80 to 209 (130 residues), 34.3 bits, E=3.3e-12
• PF01053: Cys_Met_Meta_PP
  • amino acids 112 to 229 (118 residues), 28.2 bits, E=1.5e-10

Best Hits

Swiss-Prot: 100% identical to CSD_SYNY3: Probable cysteine desulfurase (csd) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 100% identity to syn:slr0077)

MetaCyc: 50% identical to L-cysteine desulfurase (Escherichia coli K-12 substr. MG1655)
Selenocysteine lyase. [EC: 4.4.1.16]; Cysteine desulfurase. [EC: 4.4.1.16, 2.8.1.7]

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• superpathway of L-alanine biosynthesis (2/4 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• molybdopterin biosynthesis (1/6 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Protein Sequence (420 amino acids)

>SGL_RS15265 SufS family cysteine desulfurase (Synechocystis sp000284455 PCC 6803)
MVALQIPSLAATVRQDFPILNQEINGHPLVYLDNAATSQKPRAVLEKLMHYYENDNANVH
RGAHQLSVRATDAYEAVRNKVAKFINARSPREIVYTRNATEAINLVAYSWGMNNLKAGDE
IITTVMEHHSNLVPWQMVAAKTGAVLKFVQLDEQESFDLEHFKTLLSEKTKLVTVVHISN
TLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAPTGIGF
LYGKEEILEAMPPFFGGGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTD
LGMENIHNYEVELTHYLWQGLGQIPQLRLYGPNPKHGDRAALASFNVAGLHASDVATMVD
QDGIAIRSGHHCTQPLHRLFDASGSARASLYFYNTKEEIDLFLQSLQATIRFFSDDDFTV