Protein Info for SGL_RS14775 in Synechocystis sp000284455 PCC 6803

Annotation: ferredoxin--nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF03460: NIR_SIR_ferr" amino acids 54 to 114 (61 residues), 62.6 bits, see alignment E=2.3e-21 amino acids 305 to 369 (65 residues), 65.7 bits, see alignment E=2.5e-22 PF01077: NIR_SIR" amino acids 125 to 282 (158 residues), 159.6 bits, see alignment E=4.5e-51 amino acids 383 to 490 (108 residues), 49.2 bits, see alignment E=4.2e-17

Best Hits

Swiss-Prot: 68% identical to NIR_PHOLA: Ferredoxin--nitrite reductase (nirA) from Phormidium laminosum

KEGG orthology group: K00366, ferredoxin-nitrite reductase [EC: 1.7.7.1] (inferred from 100% identity to syn:slr0898)

MetaCyc: 66% identical to ferredoxin--nitrite reductase (assimilatory) (Synechococcus elongatus PCC 7942 = FACHB-805)
Ferredoxin--nitrite reductase. [EC: 1.7.7.1]

Predicted SEED Role

"Ferredoxin--nitrite reductase (EC 1.7.7.1)" in subsystem Nitrate and nitrite ammonification (EC 1.7.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>SGL_RS14775 ferredoxin--nitrite reductase (Synechocystis sp000284455 PCC 6803)
MANKFETVKATKDGLAVRAELEHFAQIGWENIPEEDRDLRLKWLGIFFRPVTPGEFMLRF
RIPHGLLTSQQLQVIGDIINRYGDRGNGDITTRQNLQVRGIKIEDIPDIFSKLESCGLTS
VQSGMDNVRNITGSPVAGLEKDELIDTRDLVQGVQDMITNGGRGNPEFTNLPRKFNIAIE
GSRDNSVHAEINDVAFVPAYREGILGFNVVVGGFFSSRRCEAAIPLDAWVQPDQQVVDLC
RSILEIYRDHGLRANRQKSRLMWLIDEWGVAKFREEVAAKLPFPLLTAAPKDELDWDKRD
HLGVHPQKQAGLNYVGLHVPVGRLYANDFFELSRLADTYGSGEVRLTVEQNLILVNVPDE
KLEALLAEPLLTKFRVDPHNLQRSVVSCTGAQFCKFALIETKNRALAMVAALEKELTVPK
PVRIHWTGCPNSCGQPQVADIGLMGTKVRKDGKTVDGADVYLGGKVGKDAHLGTCVHKSI
PCDELQPLLAQILIEQFGAVRR