Protein Info for SGL_RS14195 in Synechocystis sp000284455 PCC 6803

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 77 to 107 (31 residues), see Phobius details amino acids 119 to 147 (29 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 23 to 313 (291 residues), 315.3 bits, see alignment E=1.6e-98 PF00528: BPD_transp_1" amino acids 97 to 314 (218 residues), 67.7 bits, see alignment E=5.6e-23

Best Hits

Swiss-Prot: 43% identical to PSTC_PASMU: Phosphate transport system permease protein PstC (pstC) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to syn:sll0681)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>SGL_RS14195 phosphate ABC transporter permease subunit PstC (Synechocystis sp000284455 PCC 6803)
MTTAPYSRTKPLASRSDLEKNLEKGFKYLTLAFAVSIGLILLAIALLILSQSVPAIKAFG
LGFITNNTWNPVTSQYGILAIMVGTLVNSGLALLLAIPLGIGTALFLSEDFIPSKIRTVL
TFMVELLAAIPSVVYGLWGIFVIIPLIKPVGMWLNEYFGWIPLFSTPPAGPGMLPASIVL
AIMILPIITAIARDSLASLPPELRQASLGLGATRWETIFRVLIPAAFSGIVGGIMLALGR
AMGETMAVTMIIGNSNRLSWSLLNPANTIASLLANQFAEASGMQVSALMYAGFVLIVLTF
IVNILAELIVNKVKAKY