Protein Info for SGL_RS14190 in Synechocystis sp000284455 PCC 6803

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 21 to 285 (265 residues), 309.6 bits, see alignment E=8.1e-97 PF00528: BPD_transp_1" amino acids 88 to 284 (197 residues), 53.3 bits, see alignment E=1.5e-18

Best Hits

Swiss-Prot: 41% identical to PSTA_HAEIN: Phosphate transport system permease protein PstA (pstA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to syn:sll0682)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>SGL_RS14190 phosphate ABC transporter permease PstA (Synechocystis sp000284455 PCC 6803)
MTAVNLQKKKSDLRAIFGYSMTAVSAACLLATVIPLFAVLIFVAIQGFRSLNLNLFLKLP
PAPGLAGGGVGNAIIGTFIVVAIATVIAVPIGVLSAVYLSEFSGDNQVARAVRFATNLLS
GIPSIIAGVFAYGALVSSGLFGFSAIAGGVALAVLMLPTIIRTTDEALQIVPQDIRWAAL
GVGAYKYQTVLFVVLPAALSSIITGVTLAIARAAGETAPLIFTALYSNFWPRGLKEPIAT
LAVLVYNFASVPYKSQQELAWAASLLLVFLVLITNITARFFTRKKAY