Protein Info for SGL_RS14180 in Synechocystis sp000284455 PCC 6803

Annotation: phosphate ABC transporter ATP-binding protein PstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 13 to 266 (254 residues), 376.9 bits, see alignment E=2e-117 PF00005: ABC_tran" amino acids 29 to 181 (153 residues), 101.2 bits, see alignment E=7.5e-33

Best Hits

Swiss-Prot: 100% identical to PSTB2_SYNY3: Phosphate import ATP-binding protein PstB 2 (pstB2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to syn:sll0684)

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>SGL_RS14180 phosphate ABC transporter ATP-binding protein PstB (Synechocystis sp000284455 PCC 6803)
MVVSNGVATKGVLEAQGVNVYYGSHLAVKDCNISIPERRVVAFIGPSGCGKSTLLRCFNR
MNDLVSIARVEGRITYHGSDIYAPSVDPVGLRCSIGMVFQKANPFPKSIYENIAWGAKLN
NFQGDMDELVETSLRRAALWDEVKDKLKASGFSLSGGQQQRLCIARAIAVQPEVILMDEP
CSALDPISTLKIEGLMHELKEQFTIVIVTHNMQQASRVSDYTAFFNVESVDRGAKVGSLV
EYGPTEEIFQNPLKESTRDYVSGRFG