Protein Info for SGL_RS14155 in Synechocystis sp000284455 PCC 6803

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 423 to 440 (18 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 44 to 445 (402 residues), 249 bits, see alignment E=3.5e-78

Best Hits

Swiss-Prot: 100% identical to NHAS3_SYNY3: High-affinity Na(+)/H(+) antiporter NhaS3 (nhaS3) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to syn:sll0689)

Predicted SEED Role

"Na+/H+ antiporter napA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>SGL_RS14155 cation:proton antiporter (Synechocystis sp000284455 PCC 6803)
MFMNPLLPPLWPMIATAVETETEIAPLVLAGVLLSLVVIYFASKLGGEVCLRLNLPPVLG
ELVGGVLVGVSALKLLLFPEGGLAPEDSLVIQLLMGSADLSPEAAQSVFSAQSEVISVIS
ELGVIILLFEIGLESNLKELIRVGPQAAIVAVVGVVTPFSLGTIGLMTIFGVAAIPAIFA
GAALTATSIGITAKVLAEINRLSSNEGQIIIGAAVLDDILGIIVLAVVGSLVKTGEIQIS
NIIYLILSATGFVVGSILIGRLLSPFYVSLVNRMKTRGQLLLVSICVAFVLSYIAQIVQL
EAILGSFAAGLILAETEKREDLEEQILPLADFFVPVFFVCVGAKTDVSVLNPAVPANREG
LIIAAFLILVAIVGKVVTGFTLFGKSELNKLAIGVGMIPRGEVGLVFAGVGAASGALDPA
TDAAIIVMVIVTTFVAPPWLRAVFEGAKKEEAPEKPVPTPD