Protein Info for SGL_RS13880 in Synechocystis sp000284455 PCC 6803

Annotation: aminodeoxychorismate/anthranilate synthase component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 1 to 193 (193 residues), 241.9 bits, E=2.3e-76
• PF00117: GATase
  • amino acids 3 to 192 (190 residues), 197.6 bits, E=1.6e-62
• PF07722: Peptidase_C26
  • amino acids 69 to 177 (109 residues), 42.6 bits, E=6.3e-15

Best Hits

Swiss-Prot: 58% identical to TRPG_PSEAE: Anthranilate synthase component 2 (trpG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 99% identity to syn:slr0055)

MetaCyc: 58% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" (EC 2.6.1.85, EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (12/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (10/10 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Folate biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Protein Sequence (196 amino acids)

>SGL_RS13880 aminodeoxychorismate/anthranilate synthase component II (Synechocystis sp000284455 PCC 6803)
MILVIDNYDSFTYNLVQYLGELGQKYAVAEDLKVYRNDQISLEEVKSLQPDAIVISPGPG
RPDDAGISLQLIEKLSASTPILGVCLGHQSIGQVFGGKVVAAPELMHGKTSQIYHQQQGI
FAGLASPVQATRYHSLIVERESLPECLEVTAWLADGMVMAFQHRDYPHVQSVQFHPESIL
TKEGKQMLENFLQSLG