Protein Info for SGL_RS13730 in Synechocystis sp000284455 PCC 6803

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00038: translation elongation factor P
  • amino acids 2 to 184 (183 residues), 263.1 bits, E=5.9e-83
• PF08207: EFP_N
  • amino acids 3 to 60 (58 residues), 90.5 bits, E=8.3e-30
• PF01132: EFP
  • amino acids 70 to 120 (51 residues), 79.2 bits, E=2.7e-26
• PF09285: Elong-fact-P_C
  • amino acids 129 to 184 (56 residues), 99.6 bits, E=9.2e-33

Best Hits

Swiss-Prot: 100% identical to EFP_SYNY3: Elongation factor P (efp) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to syn:slr0434)

MetaCyc: 48% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Protein Sequence (187 amino acids)

>SGL_RS13730 elongation factor P (Synechocystis sp000284455 PCC 6803)
MISSNDFRTGTSIVMDGAVWKVVEFLHVKPGKGSAFVRTKLKSVQTGNVVEKTFRAGETV
PQANIEKSVMQHTYKDGDQYVFMDMETFEEVSIAPDTLGDKAKFIKEEMEVSVVTWDGTI
LDVELPTSVVLEIVETDPGVKGDTATGGTKPAILETGAQVMVPLFIAQGERIKVDTRDGS
YLGRDNA