Protein Info for SGL_RS13325 in Synechocystis sp000284455 PCC 6803

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 14 to 115 (102 residues), 47.3 bits, see alignment E=2.3e-16 PF00528: BPD_transp_1" amino acids 126 to 331 (206 residues), 136.7 bits, see alignment E=7.8e-44

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to syn:sll0312)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>SGL_RS13325 ABC transporter permease (Synechocystis sp000284455 PCC 6803)
MRNPLRWLQNDDFAYVVQRLIEGLITLLLASLLSFAIVQLAPGSYLDTLQQNPKISPETL
QQLKVQFGLDQPWYVQYWRWLTQVVTRFNFGESFVYNRSVASLLIERIPATLLLAITSII
LTWAIAIPLGIVGAVQQNTFIDRSLRVISYIGQGFPSFITALLLLFLAQSVSPLLPVGDM
TSIDFAEFSWPHKVWDVAWHMILPTLALSITSFAGLQRLMRGQLLDVLRQDYIQTARAKG
LPENRVIYVHALRNAINPLITILGFEFASLLSGAFIAEFFFNWPGLGRLILQAVTAQDLY
LVMGSLMMGATLLIVGNLLADLLLKFTDPRIQLADLK