Protein Info for SGL_RS13140 in Synechocystis sp000284455 PCC 6803

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08534: Redoxin
  • amino acids 7 to 145 (139 residues), 64.8 bits, E=1.2e-21
• PF00578: AhpC-TSA
  • amino acids 7 to 139 (133 residues), 146 bits, E=8.2e-47
• PF10417: 1-cysPrx_C
  • amino acids 160 to 195 (36 residues), 39.2 bits, 8e-14

Best Hits

Swiss-Prot: 100% identical to Y755_SYNY3: Putative peroxiredoxin sll0755 (sll0755) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to syn:sll0755)

MetaCyc: 58% identical to peroxiredoxin-1 (Homo sapiens)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Protein Sequence (200 amino acids)

>SGL_RS13140 peroxiredoxin (Synechocystis sp000284455 PCC 6803)
MTEVLRVGQPAPDFTATAIVDQSFQTVKLSTYRGKYLVLFFYPLDFTFVCPTEIIAFSDR
HSEFTALDTEVVGISVDSEFSHLAWIQTERKMGGIGNINYPLVSDLKKEISQAYNVLEPD
AGIALRGLFIIDREGILQYATVNNLSFGRSVDETLRVLKAIRHVQSHPNEVCPVDWQEGD
KTMIPDPEKAKTYFETVAEP