Protein Info for SGL_RS11640 in Synechocystis sp000284455 PCC 6803

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details PF13432: TPR_16" amino acids 110 to 167 (58 residues), 21.7 bits, see alignment E=1.2e-07 amino acids 189 to 246 (58 residues), 20.6 bits, see alignment E=2.6e-07 PF14559: TPR_19" amino acids 118 to 163 (46 residues), 27.2 bits, see alignment 2e-09 PF13181: TPR_8" amino acids 188 to 217 (30 residues), 18.7 bits, see alignment (E = 7.3e-07) PF13176: TPR_7" amino acids 189 to 211 (23 residues), 18.2 bits, see alignment (E = 1e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:slr1644)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>SGL_RS11640 tetratricopeptide repeat protein (Synechocystis sp000284455 PCC 6803)
MATSRTQRDVWVYVGIGAMVSALVLFSLVPLVMGLWQPRPAADGVVNGGTPLESQALGYQ
LVLEREPDNVNALQGLLEIRLQQKNLAAAIAPLERLGQIRTDQVQYRILLAQLKTQLEDN
AGAAKVYREILTQSPHNIQALKGLSGLYAQQERPAEAVAIVQNAITQAIKAQTGAPGTVP
PDQLTSLQLLLGEIYLSQNRPDQAIAIYEAASKVNGNDFRPVLAQAQVMAQTGKVKEADP
FFQQAIMLAPVQYKDPIKNIALQVTNQALANQNGAPETSIPSPAPILKSE