Protein Info for SGL_RS11630 in Synechocystis sp000284455 PCC 6803

Annotation: phycobilisome linker polypeptide

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 266 to 279 (14 residues), see Phobius details PF01383: CpcD" amino acids 18 to 75 (58 residues), 78.3 bits, see alignment E=4.2e-26 PF00175: NAD_binding_1" amino acids 266 to 379 (114 residues), 92.8 bits, see alignment E=2.1e-30

Best Hits

Swiss-Prot: 100% identical to FENR_SYNY3: Ferredoxin--NADP reductase (petH) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02641, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 100% identity to syn:slr1643)

MetaCyc: 100% identical to ferredoxin--NADP reductase (small isoform) (Synechocystis sp. PCC 6803)
Ferredoxin--NADP(+) reductase. [EC: 1.18.1.2]

Predicted SEED Role

"Ferredoxin-NADP(+) reductase (EC 1.18.1.2)" in subsystem Cytochrome B6-F complex (EC 1.18.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>SGL_RS11630 phycobilisome linker polypeptide (Synechocystis sp000284455 PCC 6803)
MYSPGYVATSSRQSDAGNRLFVYEVIGLSQSTMTDGLDYPIRRSGSTFITVPLKRMNQEM
RRITRMGGKIVSIKPLEGDSPLPHTEGIAKPSQSEGSGSEAVANPAPESNKTMTTTPKEK
KADDIPVNIYRPKTPYIGKVLENYPLVREGAIGTVQHLTFDLSAGDLRYLEGQSIGIIPP
GEDDKGKPHKLRLYSIASTRHGDFGDDKTVSLCVRQLEYQNEAGETVQGVCSTYLCNIKE
GDDIAITGPVGKEMLLPPDEDANIVMLATGTGIAPFRAFLWRMFKEQHEDYKFKGLAWLI
FGIPKSENILYKDDLEKMAAEFPDNFRLTYAISREQQNAEGGRMYIQHRVAENAEELWNL
MQNPKTHTYMCGLKGMEPGIDEAFTALAEQNGKEWTTFQREMKKEHRWHVETY