Protein Info for SGL_RS11440 in Synechocystis sp000284455 PCC 6803

Annotation: 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 124 to 364 (241 residues), 307.1 bits, E=4.1e-96
• PF08032: SpoU_sub_bind
  • amino acids 125 to 201 (77 residues), 79.8 bits, E=1.5e-26
• PF00588: SpoU_methylase
  • amino acids 218 to 358 (141 residues), 144.8 bits, E=2e-46

Best Hits

Swiss-Prot: 100% identical to Y955_SYNY3: Uncharacterized tRNA/rRNA methyltransferase slr0955 (slr0955) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to syn:slr0955)

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (384 amino acids)

>SGL_RS11440 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB (Synechocystis sp000284455 PCC 6803)
MTEMPKKKFSPRSARGDKPRYGEQKPKLKRSGDKPRFNDDQPQGFKEKSDRFQDKPRPRT
NDDKPRRAGDKPSNFKSRFKDKDRDKPRYGDDRPRRSGQKPPFGKTFPAAPPPMDSEQAQ
EALDLLYGHHAVLAALDGDRQLNRIWITSHLRHDIRYRTKIQTAKANGTVVDEVDNFRLN
QITHNANHQGIAAQVAPYHYWELGDLIDKAKSQSTAPVLIIIDSITDPHNLGAIIRTAEA
FGAQGMVLPQRRVAGITSTVMKVAAGALEHFPVARVVNLSRALETLKESGFWIYGTVAGK
QTALHQADLREPMGLVIGSEGEGLSLLTQKHCDHLITIPLAGKTPSLNASVAAAISLYEI
FRQRGFDRPTLSHTASDLREVSED