Protein Info for SGL_RS11110 in Synechocystis sp000284455 PCC 6803

Annotation: hydrogenase maturation nickel metallochaperone HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 TIGR00100: hydrogenase nickel insertion protein HypA" amino acids 1 to 112 (112 residues), 142.7 bits, see alignment E=2.4e-46 PF01155: HypA" amino acids 1 to 111 (111 residues), 108.6 bits, see alignment E=9.2e-36

Best Hits

Swiss-Prot: 100% identical to HYPA1_SYNY3: Hydrogenase maturation factor HypA 1 (hypA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to syn:slr1675)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>SGL_RS11110 hydrogenase maturation nickel metallochaperone HypA (Synechocystis sp000284455 PCC 6803)
MHEVSLMEQTLAIAIAQAEDHGASQIHRLTLRVGQQSGVVADALRFAFEVVRQNTMAAEA
RLEIEEIPVTCRCQHCHENFQPEDWIYRCPHCDQISQTVMDGKQLELASLELS