Protein Info for SGL_RS10615 in Synechocystis sp000284455 PCC 6803

Annotation: D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02113: Peptidase_S13" amino acids 81 to 164 (84 residues), 54.1 bits, see alignment E=1.1e-18 amino acids 213 to 381 (169 residues), 96.8 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:sll1369)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>SGL_RS10615 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase (Synechocystis sp000284455 PCC 6803)
MVRIFGATVLALLSWGGAGEPLVGQEVAWQEAKVFAVPTQADPAIDKIVDNYLDRLESLG
YDRQRQGIWLQSEWAYLGYNQGESAFPAASLTKIATSVAALDKWAPNHRFITRFYTDGPI
HNGVLEGNLFVAGDHDPLFVWEEAIAVGNALNQAGIREVTGDLVAVGNFAMNFEANPAIA
GALFQQAVDESQWSATVSQAFGDLPPNTPRPQVKIAGAVQTQAVLPANLEPLLEHQSLPL
AALLKQMNIYSNNDMAEMLAQAIGGAAIVAQTTSRLGAIPAAEIQLKNGSGLGVDNRLSP
RAVTKMYQVLAAQLEPHGLGIDDIFPVMGRDRRGTLEWRSMPQGLTIKTGTLNTVSALAG
TIPTQERGTVWFAIINNGPNFDRLRVEQDRLLQQIAEHWQVLPENLNAGPMDKVLLGDPA
RNLTPPPSES