Protein Info for SGL_RS10415 in Synechocystis sp000284455 PCC 6803

Annotation: SpoIIE family protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 PF00512: HisKA" amino acids 15 to 66 (52 residues), 37.4 bits, see alignment 3.3e-13 PF00072: Response_reg" amino acids 192 to 303 (112 residues), 87.9 bits, see alignment E=7.8e-29 PF07228: SpoIIE" amino acids 378 to 600 (223 residues), 158.4 bits, see alignment E=3.2e-50

Best Hits

KEGG orthology group: K02485, two-component system, unclassified family, response regulator (inferred from 100% identity to syn:slr1983)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (603 amino acids)

>SGL_RS10415 SpoIIE family protein phosphatase (Synechocystis sp000284455 PCC 6803)
MMNPSINSVDIESATAFIRHELRTPINAIVGYGEMVQEELAEANSPLTEEIDTLLVEAQK
LLEIINLFVKHSDGEDKSDFQKLFSTIPHSTNFSITNIILNCDSLLEAEECTNELELTED
IRKIKLAALRLQGLVNNIESIFTNFLESLNPGNGTGLSPDFIFPSSSNTNEISLGNIKTN
GVDSRELLKGKILVVDDNPSNLDLFFQHLTRKGHAVTTCLSAKDALGLLQSQNYDLILLD
LLMPETNGDQFLEYLKTSVEFQHIPVIIVSALDEFESIIRCIEMGAEDFLPKPFDPVLLK
ARIGSSLEKKRLRDQEKLYTQQVEGLSEMMAKELEKGRQMQKNFLPAHLLTRSGWEFSAY
FSPAQQLAGDFYDLFELPGDRLGIVVADVCDKGVGAALFMGLFRSLIRIFSGQAALDGLI
NPSFNLPSGQGLLDVNLDNLLNNINFEPLESIKLINNYVAINHGEASMFATIFFGILEPS
SGKLSYINGGHEPVFIVDSNHQLKTKLTSTGPAVGMLPDLQFKTAEIILQPGDLLLSYTD
GVTEAKSPTGNFFGKEKLLNALGSSFNSVDQLMLNIKESLEEHMGEAQQFDDITLLAIKF
QTT