Protein Info for SGL_RS10020 in Synechocystis sp000284455 PCC 6803

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22769: DCD
  • amino acids 4 to 166 (163 residues), 85 bits, E=3.1e-28
• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 16 to 191 (176 residues), 110.5 bits, E=3.8e-36

Best Hits

Swiss-Prot: 50% identical to DCD_CHRVO: dCTP deaminase (dcd) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to syn:sll1258)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (3/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Protein Sequence (193 amino acids)

>SGL_RS10020 dCTP deaminase (Synechocystis sp000284455 PCC 6803)
MIKNDIWIRAQAAQGMIEPFEPKLMRQIEGQPAISFGLSSFGYDIRLSAADFRIFRHIPG
TVVDPKNFNPHNLEATQLHRDDSGSYFILPAHSYGLGVAVERLAIPANVTVLCIGKSTYA
RAGIIANLTPGEAGWCGHLTLEFSNSSSADCRIYANEGIVQLLFFEGEDCDISYETRRGK
YQNQPQSVTLPRV