Protein Info for SGL_RS09325 in Synechocystis sp000284455 PCC 6803

Annotation: beta-ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 311 to 328 (18 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 9 to 330 (322 residues), 369.7 bits, see alignment E=5.9e-115 PF08545: ACP_syn_III" amino acids 110 to 187 (78 residues), 113.2 bits, see alignment E=4.2e-37 PF08541: ACP_syn_III_C" amino acids 242 to 330 (89 residues), 133.5 bits, see alignment E=2.4e-43

Best Hits

Swiss-Prot: 100% identical to FABH_SYNY3: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to syn:slr1511)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>SGL_RS09325 beta-ketoacyl-ACP synthase III (Synechocystis sp000284455 PCC 6803)
MNTLGSGLKIIGSGTAIADQSLTNQDLSNIVETSDEWIQSRTGMRQRYICSAQENLASLG
VKAGQKALAMAGLQPEDLDLIILATSTPDDLFGTAAQIQGGLGATRAFAFDITAACSGFV
VGLNVAAQFLRTGVYQRVLIVGGDVLSRWVDWSDRTTCVLFGDGAGAVVLQRQAQDNLLA
FEMYTDGTGNGCLNLSYQANPQPLTAEKTVAQGTYQAITMNGREVYRFAVAKVPEIIEKV
LFKAQLTTSDLDWVILHQANQRIMDAVGDRLGIPSEKIISNVGEYGNTSAASIPLALDQA
VREGKIKEGDLIALAGFGAGLTWAASIVRW