Protein Info for SGL_RS08810 in Synechocystis sp000284455 PCC 6803

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 144 to 160 (17 residues), see Phobius details amino acids 184 to 200 (17 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details PF00950: ABC-3" amino acids 19 to 273 (255 residues), 328.9 bits, see alignment E=2.3e-102 PF01032: FecCD" amino acids 68 to 271 (204 residues), 28.4 bits, see alignment E=8.5e-11

Best Hits

Swiss-Prot: 100% identical to MNTB_SYNY3: Manganese transport system membrane protein MntB (mntB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K11602, manganese transport system permease protein (inferred from 100% identity to syn:sll1600)

Predicted SEED Role

"ABC transporter component, possibly Mn transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>SGL_RS08810 metal ABC transporter permease (Synechocystis sp000284455 PCC 6803)
MNQLVVAFPFWHWLVEPLQYEFLIRAIWVSAFVGLVCAVLSCYITLKGWSLMGDAISHAV
VPGVVLAYALNIPFAIGAFTFGFGATVAIGYVKSKTRLKEDAVIGIVFTGFFALGLVLVT
KIPSNVDLFHILFGNVLGISQQDIIQTLIAGSITLIVILLRRKDLLLFCFDPNHAKAIGL
RTQVMYYTLLSVLALTIVAALQTAGIILVISMLVTPGSIGYLLSDRFDHMLWYSVVSSVL
SCVLGTYLSYHFDVSTGGMIVVILTTLFVIAMIGAPKYGILAQEWRKRSGPNPEDDENQT
VVVDQV