Protein Info for SGL_RS08090 in Synechocystis sp000284455 PCC 6803

Annotation: photosystem II reaction center protein Psb28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03912: Psb28
  • amino acids 8 to 119 (112 residues), 115.9 bits, E=5.2e-38
• TIGR03047: photosystem II reaction center protein Psb28
  • amino acids 8 to 121 (114 residues), 125.1 bits, E=7.3e-41

Best Hits

KEGG orthology group: K08904, photosystem II Psb28-2 protein (inferred from 100% identity to syn:slr1739)

MetaCyc: 51% identical to Photosystem II reaction center psb28 protein (Synechococcus elongatus PCC 7942 = FACHB-805)
PSII-RXN [EC: 1.10.3.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

• ethene biosynthesis V (engineered) (24/25 steps found)
• oxygenic photosynthesis (17/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (23/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (22/27 steps found)
• photosynthesis light reactions (4/4 steps found)
• superpathway of photosynthetic hydrogen production (5/6 steps found)
• protective electron sinks in the thylakoid membrane (PSII to PTOX) (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.9

Use Curated BLAST to search for 1.10.3.9

Protein Sequence (122 amino acids)

>SGL_RS08090 photosystem II reaction center protein Psb28 (Synechocystis sp000284455 PCC 6803)
MMTLTPTIEFFADLPEELSNVSLRRNSTTGARTVVMTFERLQAIEKFQSFTQRFNGHLRL
ADEEGAMEIEPSSVKFIFGGDEGDELRGAQCSFDLVKNDHWERFIRFMERYAEANGMGYQ
DR