Protein Info for SGL_RS08065 in Synechocystis sp000284455 PCC 6803

Annotation: homogentisate phytyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 100 to 128 (29 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details PF01040: UbiA" amino acids 39 to 286 (248 residues), 145.9 bits, see alignment E=6.6e-47

Best Hits

Swiss-Prot: 100% identical to HGGT_SYNY3: Homogentisate phytyltransferase (slr1736) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09833, homogenitisate phytyltransferase (inferred from 100% identity to syn:slr1736)

MetaCyc: 100% identical to homogentisate phytyltransferase (Synechocystis sp. PCC 6803)
RXN-2541 [EC: 2.5.1.115]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>SGL_RS08065 homogentisate phytyltransferase (Synechocystis sp000284455 PCC 6803)
MATIQAFWRFSRPHTIIGTTLSVWAVYLLTILGDGNSVNSPASLDLVFGAWLACLLGNVY
IVGLNQLWDVDIDRINKPNLPLANGDFSIAQGRWIVGLCGVASLAIAWGLGLWLGLTVGI
SLIIGTAYSVPPVRLKRFSLLAALCILTVRGIVVNLGLFLFFRIGLGYPPTLITPIWVLT
LFILVFTVAIAIFKDVPDMEGDRQFKIQTLTLQIGKQNVFRGTLILLTGCYLAMAIWGLW
AAMPLNTAFLIVSHLCLLALLWWRSRDVHLESKTEIASFYQFIWKLFFLEYLLYPLALWL
PNFSNTIF