Protein Info for SGL_RS08020 in Synechocystis sp000284455 PCC 6803

Annotation: DASH family cryptochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR02765: cryptochrome, DASH family" amino acids 7 to 435 (429 residues), 603.1 bits, see alignment E=1.5e-185 PF00875: DNA_photolyase" amino acids 8 to 168 (161 residues), 133.1 bits, see alignment E=9.6e-43 PF03441: FAD_binding_7" amino acids 288 to 478 (191 residues), 231.9 bits, see alignment E=5e-73

Best Hits

Swiss-Prot: 100% identical to CRYD_SYNY3: Cryptochrome DASH (cry) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01669, deoxyribodipyrimidine photo-lyase [EC: 4.1.99.3] (inferred from 100% identity to syn:sll1629)

Predicted SEED Role

"Cryptochrome"

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.3

Use Curated BLAST to search for 4.1.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>SGL_RS08020 DASH family cryptochrome (Synechocystis sp000284455 PCC 6803)
MKHVPPTVLVWFRNDLRLHDHEPLHRALKSGLAITAVYCYDPRQFAQTHQGFAKTGPWRS
NFLQQSVQNLAESLQKVGNKLLVTTGLPEQVIPQIAKQINAKTIYYHREVTQEELDVERN
LVKQLTILGIEAKGYWGSTLCHPEDLPFSIQDLPDLFTKFRKDIEKKKISIRPCFFAPSQ
LLPSPNIKLELTAPPPEFFPQINFDHRSVLAFQGGETAGLARLQDYFWHGDRLKDYKETR
NGMVGADYSSKFSPWLALGCLSPRFIYQEVKRYEQERVSNDSTHWLIFELLWRDFFRFVA
QKYGNKLFNRGGLLNKNFPWQEDQVRFELWRSGQTGYPLVDANMRELNLTGFMSNRGRQN
VASFLCKNLGIDWRWGAEWFESCLIDYDVCSNWGNWNYTAGIGNDARDFRYFNIPKQSQQ
YDPQGTYLRHWLPELKNLPGDKIHQPWLLSATEQKQWGVQLGVDYPRPCVNFHQSVEARR
KIEQMGVIA