Protein Info for SGL_RS06705 in Synechocystis sp000284455 PCC 6803

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 48 to 76 (29 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 355 to 384 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 16 to 360 (345 residues), 172.5 bits, see alignment E=1.3e-54 PF01740: STAS" amino acids 399 to 497 (99 residues), 54.3 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 56% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to syn:slr1229)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>SGL_RS06705 SulP family inorganic anion transporter (Synechocystis sp000284455 PCC 6803)
MINWTILKREWFRNTKEDLLAGAVVGLALIPEAIAFSIIAGVDPKVGLYASFTIAVLTAF
FGGRSGSISAATGAMALLMVDLVKDHGLQYLLAATVLTGIFQVLLGVFKVAKQMRYVPRA
VVLGYINALAVLIFLAQLPQLDPTKVSQYWLVYLILACSLAIIYILPTFTKVFPSPLVAL
FVMTNATIFLQLDVPTVGDMGELPGSLPIFLLPQIPFNWQTLQIILPYSLTLAIVGLLAS
FLTASLVDELTDTPSDKNREAKGQGIANIVTGFFGGMAGCGMIGQSVINVQSGGRGRLST
FAAGIFLLIAILGLKDWVQQMPMATLVAVMIMVSIGTFRWSSLRDFRKIPQSENIVMFTT
MGLIIITRNFALGVAAGIIMSTIFFTRKIAQLVFVDRVLTEDENHRIYNVSGQIFFVSKE
EFLEAFDFDELVDRVTIDLTHAHLWDQGAVGTVEQIMTKFRRNGIDVELVGLNGASATLW
QKLIKEPELKLINSSAEN