Protein Info for SGL_RS04215 in Synechocystis sp000284455 PCC 6803

Annotation: MlaE family lipid ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 75 to 79 (5 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 139 to 183 (45 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 2 to 257 (256 residues), 364.4 bits, see alignment E=1.8e-113 PF02405: MlaE" amino acids 42 to 252 (211 residues), 258.6 bits, see alignment E=2.1e-81

Best Hits

Swiss-Prot: 100% identical to Y1045_SYNY3: Probable ABC transporter permease protein slr1045 (slr1045) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to syn:slr1045)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>SGL_RS04215 MlaE family lipid ABC transporter permease subunit (Synechocystis sp000284455 PCC 6803)
MSDRGSRHSLSLWFQRLVAAFFLTGQVFLHILQGRINRRNTLEQMNMVGPESMAIALITA
GFVGMVFTIQVAREFIYYGATTTIGGVLSLSLTRELAPVLTAVVIAGRVGSAFAAEIGTM
RVTEQLDALYMLRTDPIDYLVVPRVIACGLMLPILTGLSLFVGMAGGLVISSSLYAINPT
IFLNSVQNFTQLWDVFACLFKSLVFGVIIAIIGCSWGLTTTGGAKGVGESTTTAVVTSLL
AIFISNFFLSWLMFQGTGDTALG