Protein Info for SGL_RS03970 in Synechocystis sp000284455 PCC 6803

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17792: ThiD2
  • amino acids 11 to 129 (119 residues), 141.9 bits, E=1.4e-45
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 144 to 334 (191 residues), 245.2 bits, E=1.7e-77
• PF02581: TMP-TENI
  • amino acids 145 to 321 (177 residues), 233.5 bits, E=1.1e-73

Best Hits

Swiss-Prot: 100% identical to THIE_SYNY3: Thiamine-phosphate synthase (thiE) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to syn:sll0635)

Predicted SEED Role

No annotation

MetaCyc Pathways

• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiamine diphosphate salvage II (2/5 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (2/7 steps found)
• thiamine diphosphate salvage IV (yeast) (1/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (1/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (343 amino acids)

>SGL_RS03970 thiamine phosphate synthase (Synechocystis sp000284455 PCC 6803)
MQQASPTAIARILDANLNRAREGLRTVEEWCRFALENRELAEECKQLRQALAPWHQDDLR
AARDTPNDVGTQLTHAQEALRTDVRALLQANLCRVEEALRVLEEYGKLRDPAMGACCKQL
RYRVYALESGLLGSKLVQRLQQCSLYLVTSPQENLLATVEAALQGGLKLVQYRDKDAEDQ
LRWQRAKDLRELCRQYEALFLVNDRVDLALAVDADGVHLGQQDLPIAVARQLLGPDKIIG
RSTTNPEEMAKAIAEGADYIGVGPVYATPTKAGKKPAGLEYVQYAVTNSPVPWFAIGGID
GENLGEVMEAGATQVAIVRAIMETTNPTQATAQLLTQLSRINP