Protein Info for SGL_RS03600 in Synechocystis sp000284455 PCC 6803

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13847: Methyltransf_31
  • amino acids 21 to 122 (102 residues), 55.9 bits, E=1.2e-18
• PF13489: Methyltransf_23
  • amino acids 21 to 172 (152 residues), 70.5 bits, E=4.4e-23
• PF05219: DREV
  • amino acids 23 to 118 (96 residues), 28.1 bits, E=3.3e-10
• PF08242: Methyltransf_12
  • amino acids 27 to 115 (89 residues), 56.7 bits, E=1e-18
• PF08241: Methyltransf_11
  • amino acids 27 to 117 (91 residues), 48.7 bits, E=2.9e-16
• PF13649: Methyltransf_25
  • amino acids 27 to 113 (87 residues), 48.3 bits, E=4.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:slr1618)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (43/59 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (6/12 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (1/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (1/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (1/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (1/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (1/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (1/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (1/11 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Protein Sequence (242 amino acids)

>SGL_RS03600 class I SAM-dependent methyltransferase (Synechocystis sp000284455 PCC 6803)
MFADYNSILGYYQAKACIEHSRGDSLLDMPCGDGTLTSLLAPAFKTVVGLDASSQHLALA
KENMPSAEFYEGLIEEFETNQKFDTITMLNILEHVVDPISVLQKAASLLSQNGILLVHVP
NALAVNRRLAVLMGTLTHCEELSPFDIQVVGHRRSYSLSTLCNDIEQAGLKINATGGVFY
KSLSTPQMDWFLANGLWEEGGFGWGRVGGEQKDWKAEFCRASYELGKQHPEDCNIIYACI
TK