Protein Info for SGL_RS03520 in Synechocystis sp000284455 PCC 6803

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 120 to 148 (29 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 29 to 235 (207 residues), 77.1 bits, see alignment E=7.1e-26

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 100% identity to syn:slr0977)

Predicted SEED Role

"O-antigen export system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>SGL_RS03520 ABC transporter permease (Synechocystis sp000284455 PCC 6803)
MKTSPPELIIEAGRTERQYWQDLWRYRELFYTLAWRDIAVRYKQTAIGIAWALIRPFLTM
VVFTVVFGKLANLPSEGVPYPILVFAGMLPWQFFSTSLSSASDSLIANANLISKVYFPRL
VVPTSAVVTSFVDFLISGMIMLGLMAWYNFLPSWHVITLPFFILIAFMASMGAGLWLCSL
NVKYRDFRYIVPFIVQFGLYISPVGFSSNVVPEKWRLLYSINPMVSVIDGFRWAILGGES
TIFLPGFLLSLLLVIIIFITGILYFRKMERTFADVI